PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.220080.1
Common NameCsa_7G074870, LOC101221044
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 386aa    MW: 42819 Da    PI: 7.6911
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.220080.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like993.2e-31239294156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF +a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Cucsa.220080.1 239 KQRRCWSPELHRRFENALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 294
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.435236296IPR017930Myb domain
SuperFamilySSF466894.83E-18237297IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-28238297IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-26239294IPR006447Myb domain, plants
PfamPF002491.3E-7241292IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MPSLSPPNSI SHFLHQISSL SNPSDRSSRL HSLITSLEDE MKKIDAFKRE LPLCMLLLND  60
AILALKDTSL QCTSSCSSPK RKPVLEEFMS LNKDSSDENE KEEDCRDKKE WMSSVQLWKT  120
DDFQNTQTKT KRNEGWGYVA AAEDRVHRKK NEEGLFVGFK PSSSSSSACP VLAAVKKEER  180
IESPICALSL VTPNLKTTRE ELVSCVLRSS GNRATSTSAA DIQSNLRTVL PPQQQPARKQ  240
RRCWSPELHR RFENALQQLG GSQVATPKQI RELMQVDGLT NDEVKSHLQK YRLHTRRLPT  300
TPAARAADQS PVVLGDLWMS QDGCGESSKV SSSQSASPQG PLQFAGNGGY STTGGDSVED  360
EEDTKSESYD YWKSQAHTGK RCINI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817921e-177LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132551e-177LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004137119.10.0PREDICTED: uncharacterized protein LOC101221044
TrEMBLA0A0A0K4U60.0A0A0A0K4U6_CUCSA; Uncharacterized protein
STRINGVIT_03s0063g01060.t011e-117(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49560.17e-44G2-like family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]